Lineage for d1lpja_ (1lpj A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300926Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 300927Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 301112Family b.60.1.2: Fatty acid binding protein-like [50847] (15 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 301175Protein Cellular retinol-binding protein IV [82157] (1 species)
  7. 301176Species Human (Homo sapiens) [TaxId:9606] [82158] (1 PDB entry)
  8. 301177Domain d1lpja_: 1lpj A: [78123]

Details for d1lpja_

PDB Entry: 1lpj (more details), 2 Å

PDB Description: human crbp iv

SCOP Domain Sequences for d1lpja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpja_ b.60.1.2 (A:) Cellular retinol-binding protein IV {Human (Homo sapiens)}
padlsgtwtllssdnfegymlalgidfatrkiakllkpqkvieqngdsftihtnsslrny
fvkfkvgeefdednrgldnrkckslviwdndrltciqkgekknrgwthwiegdklhlemf
cegqvckqtfqra

SCOP Domain Coordinates for d1lpja_:

Click to download the PDB-style file with coordinates for d1lpja_.
(The format of our PDB-style files is described here.)

Timeline for d1lpja_: