Lineage for d1lpja_ (1lpj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805063Protein Cellular retinol-binding protein IV [82157] (1 species)
  7. 2805064Species Human (Homo sapiens) [TaxId:9606] [82158] (1 PDB entry)
  8. 2805065Domain d1lpja_: 1lpj A: [78123]

Details for d1lpja_

PDB Entry: 1lpj (more details), 2 Å

PDB Description: human crbp iv
PDB Compounds: (A:) Retinol-binding protein IV, cellular

SCOPe Domain Sequences for d1lpja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpja_ b.60.1.2 (A:) Cellular retinol-binding protein IV {Human (Homo sapiens) [TaxId: 9606]}
padlsgtwtllssdnfegymlalgidfatrkiakllkpqkvieqngdsftihtnsslrny
fvkfkvgeefdednrgldnrkckslviwdndrltciqkgekknrgwthwiegdklhlemf
cegqvckqtfqra

SCOPe Domain Coordinates for d1lpja_:

Click to download the PDB-style file with coordinates for d1lpja_.
(The format of our PDB-style files is described here.)

Timeline for d1lpja_: