SCOPe 2.06: Domain d1lo5d2: 1lo5 D:121-233

Lineage for d1lo5d2 (1lo5 D:121-233)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries)

8. Domain d1lo5d2: 1lo5 D:121-233 [78121]
   Other proteins in same PDB: d1lo5a1, d1lo5a2, d1lo5b1, d1lo5b2, d1lo5d1

Details for d1lo5d2

PDB Entry: 1lo5, 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii

PDB Compounds: (D:) enterotoxin A

SCOPe Domain Sequences for d1lo5d2:

Sequence; same for both SEQRES and ATOM records:

>d1lo5d2 d.15.6.1 (D:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhiaiylyts

Timeline for d1lo5d2:

• d1lo5d2 first appeared in SCOP 1.63
  
• d1lo5d2 appears in SCOPe 2.05
  
• d1lo5d2 appears in SCOPe 2.07
  
• d1lo5d2 appears in the current release, SCOPe 2.08