SCOP 1.65: Domain d1lo5d1: 1lo5 D:1-120

Lineage for d1lo5d1 (1lo5 D:1-120)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries)

8. Domain d1lo5d1: 1lo5 D:1-120 [78120]
   Other proteins in same PDB: d1lo5a1, d1lo5a2, d1lo5b1, d1lo5b2, d1lo5d2
   mutant

Details for d1lo5d1

PDB Entry: 1lo5, 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii

SCOP Domain Sequences for d1lo5d1:

Sequence; same for both SEQRES and ATOM records:

>d1lo5d1 b.40.2.2 (D:1-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Timeline for d1lo5d1:

• d1lo5d1 first appeared in SCOP 1.63
  
• d1lo5d1 appears in SCOP 1.67
  
• d1lo5d1 appears in the current release, SCOPe 2.08