Lineage for d1lo5b2 (1lo5 B:3-92)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545431Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2545441Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)
  8. 2545474Domain d1lo5b2: 1lo5 B:3-92 [78119]
    Other proteins in same PDB: d1lo5a1, d1lo5a2, d1lo5b1, d1lo5d1, d1lo5d2
    complexed with a peptide from hemagglutinin

Details for d1lo5b2

PDB Entry: 1lo5 (more details), 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii
PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1lo5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo5b2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1lo5b2:

Click to download the PDB-style file with coordinates for d1lo5b2.
(The format of our PDB-style files is described here.)

Timeline for d1lo5b2: