SCOPe 2.07: Domain d1lo5b2: 1lo5 B:3-92

Lineage for d1lo5b2 (1lo5 B:3-92)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)

8. Domain d1lo5b2: 1lo5 B:3-92 [78119]
   Other proteins in same PDB: d1lo5a1, d1lo5a2, d1lo5b1, d1lo5d1, d1lo5d2
   complexed with a peptide from hemagglutinin

Details for d1lo5b2

PDB Entry: 1lo5, 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii

PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1lo5b2:

Sequence; same for both SEQRES and ATOM records:

>d1lo5b2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

Timeline for d1lo5b2:

• d1lo5b2 first appeared in SCOP 1.63
  
• d1lo5b2 appears in SCOPe 2.06
  
• d1lo5b2 appears in the current release, SCOPe 2.08