SCOPe 2.06: Domain d1lo5b1: 1lo5 B:93-190

Lineage for d1lo5b1 (1lo5 B:93-190)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (41 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d1lo5b1: 1lo5 B:93-190 [78118]
   Other proteins in same PDB: d1lo5a1, d1lo5a2, d1lo5b2, d1lo5d1, d1lo5d2

Details for d1lo5b1

PDB Entry: 1lo5, 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii

PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1lo5b1:

Sequence; same for both SEQRES and ATOM records:

>d1lo5b1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Timeline for d1lo5b1:

• d1lo5b1 first appeared in SCOP 1.63
  
• d1lo5b1 appears in SCOPe 2.05
  
• d1lo5b1 appears in SCOPe 2.07
  
• d1lo5b1 appears in the current release, SCOPe 2.08