SCOPe 2.01: Domain d1lnzb2: 1lnz B:158-337

Lineage for d1lnzb2 (1lnz B:158-337)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Obg GTP-binding protein middle domain [82408] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [82409] (1 PDB entry)

8. Domain d1lnzb2: 1lnz B:158-337 [78115]
   Other proteins in same PDB: d1lnza1, d1lnzb1
   complexed with g4p, mg

Details for d1lnzb2

PDB Entry: 1lnz, 2.6 Å

PDB Description: Structure of the Obg GTP-binding protein

PDB Compounds: (B:) SPO0B-associated GTP-binding protein

SCOPe Domain Sequences for d1lnzb2:

Sequence, based on SEQRES records:

>d1lnzb2 c.37.1.8 (B:158-337) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}
ladvglvgfpsvgkstllsvvssakpkiadyhfttlvpnlgmvetddgrsfvmadlpgli
egahqgvglghqflrhiertrvivhvidmsglegrdpyddyltinqelseynlrlterpq
iivankmdmpeaaenleafkekltddypvfpisavtreglrellfevanqlentpefply

Sequence, based on observed residues (ATOM records):

>d1lnzb2 c.37.1.8 (B:158-337) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}
ladvglvgfpsvgkstllsvvssakpkipnlgmvetddgrsfvmadlpglieghqflrhi
ertrvivhvidmsglegrdpyddyltinqelseynlrlterpqiivankmdmpeaaenle
afkekltddypvfpisavtreglrellfevanqlentpefply

Timeline for d1lnzb2:

• d1lnzb2 first appeared in SCOP 1.63
  
• d1lnzb2 appears in SCOP 1.75
  
• d1lnzb2 appears in SCOPe 2.02
  
• d1lnzb2 appears in the current release, SCOPe 2.07