Lineage for d1lnzb2 (1lnz B:158-337)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110585Protein Obg GTP-binding protein middle domain [82408] (2 species)
  7. 2110586Species Bacillus subtilis [TaxId:1423] [82409] (1 PDB entry)
  8. 2110588Domain d1lnzb2: 1lnz B:158-337 [78115]
    Other proteins in same PDB: d1lnza1, d1lnza3, d1lnzb1, d1lnzb3
    complexed with g4p, mg

Details for d1lnzb2

PDB Entry: 1lnz (more details), 2.6 Å

PDB Description: Structure of the Obg GTP-binding protein
PDB Compounds: (B:) SPO0B-associated GTP-binding protein

SCOPe Domain Sequences for d1lnzb2:

Sequence, based on SEQRES records: (download)

>d1lnzb2 c.37.1.8 (B:158-337) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}
ladvglvgfpsvgkstllsvvssakpkiadyhfttlvpnlgmvetddgrsfvmadlpgli
egahqgvglghqflrhiertrvivhvidmsglegrdpyddyltinqelseynlrlterpq
iivankmdmpeaaenleafkekltddypvfpisavtreglrellfevanqlentpefply

Sequence, based on observed residues (ATOM records): (download)

>d1lnzb2 c.37.1.8 (B:158-337) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}
ladvglvgfpsvgkstllsvvssakpkipnlgmvetddgrsfvmadlpglieghqflrhi
ertrvivhvidmsglegrdpyddyltinqelseynlrlterpqiivankmdmpeaaenle
afkekltddypvfpisavtreglrellfevanqlentpefply

SCOPe Domain Coordinates for d1lnzb2:

Click to download the PDB-style file with coordinates for d1lnzb2.
(The format of our PDB-style files is described here.)

Timeline for d1lnzb2: