Lineage for d1lnwf_ (1lnw F:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533653Family a.4.5.28: MarR-like transcriptional regulators [63379] (8 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 533657Protein MexR repressor [81686] (1 species)
  7. 533658Species Pseudomonas aeruginosa [TaxId:287] [81687] (1 PDB entry)
  8. 533664Domain d1lnwf_: 1lnw F: [78109]

Details for d1lnwf_

PDB Entry: 1lnw (more details), 2.1 Å

PDB Description: crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa

SCOP Domain Sequences for d1lnwf_:

Sequence, based on SEQRES records: (download)

>d1lnwf_ a.4.5.28 (F:) MexR repressor {Pseudomonas aeruginosa}
ypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqmc
rdkalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelfap
ltpveqatlvhlldqcl

Sequence, based on observed residues (ATOM records): (download)

>d1lnwf_ a.4.5.28 (F:) MexR repressor {Pseudomonas aeruginosa}
ypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqmc
rdkalitrkirelegrnlvrrerfqlfltdeglaihqhaeaimsrvhdelfapltpveqa
tlvhlldqcl

SCOP Domain Coordinates for d1lnwf_:

Click to download the PDB-style file with coordinates for d1lnwf_.
(The format of our PDB-style files is described here.)

Timeline for d1lnwf_: