Lineage for d1lnwe_ (1lnw E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693720Protein MexR repressor [81686] (1 species)
  7. 2693721Species Pseudomonas aeruginosa [TaxId:287] [81687] (3 PDB entries)
  8. 2693730Domain d1lnwe_: 1lnw E: [78108]

Details for d1lnwe_

PDB Entry: 1lnw (more details), 2.1 Å

PDB Description: crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa
PDB Compounds: (E:) Multidrug resistance operon repressor

SCOPe Domain Sequences for d1lnwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnwe_ a.4.5.28 (E:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]}
nypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqm
crdkalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelfa
pltpveqatlvhlldqclaaq

SCOPe Domain Coordinates for d1lnwe_:

Click to download the PDB-style file with coordinates for d1lnwe_.
(The format of our PDB-style files is described here.)

Timeline for d1lnwe_: