Lineage for d1lnwd_ (1lnw D:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210555Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 210893Family a.4.5.28: MarR-like transcriptional regulators [63379] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 210894Protein MexR repressor [81686] (1 species)
  7. 210895Species Pseudomonas aeruginosa [TaxId:287] [81687] (1 PDB entry)
  8. 210899Domain d1lnwd_: 1lnw D: [78107]

Details for d1lnwd_

PDB Entry: 1lnw (more details), 2.1 Å

PDB Description: crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa

SCOP Domain Sequences for d1lnwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnwd_ a.4.5.28 (D:) MexR repressor {Pseudomonas aeruginosa}
nypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqm
crdkalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelfa
pltpveqatlvhlldqcl

SCOP Domain Coordinates for d1lnwd_:

Click to download the PDB-style file with coordinates for d1lnwd_.
(The format of our PDB-style files is described here.)

Timeline for d1lnwd_: