Lineage for d1lnwc_ (1lnw C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307134Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2307138Protein MexR repressor [81686] (1 species)
  7. 2307139Species Pseudomonas aeruginosa [TaxId:287] [81687] (3 PDB entries)
  8. 2307146Domain d1lnwc_: 1lnw C: [78106]

Details for d1lnwc_

PDB Entry: 1lnw (more details), 2.1 Å

PDB Description: crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa
PDB Compounds: (C:) Multidrug resistance operon repressor

SCOPe Domain Sequences for d1lnwc_:

Sequence, based on SEQRES records: (download)

>d1lnwc_ a.4.5.28 (C:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]}
nypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqm
crdkalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelfa
pltpveqatlvhlldqclaaqpledi

Sequence, based on observed residues (ATOM records): (download)

>d1lnwc_ a.4.5.28 (C:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]}
nypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqm
crdkalitrkirelegrnlvrrerfqlfltdeglaihqhaeaimsrvhdelfapltpveq
atlvhlldqclaaqpledi

SCOPe Domain Coordinates for d1lnwc_:

Click to download the PDB-style file with coordinates for d1lnwc_.
(The format of our PDB-style files is described here.)

Timeline for d1lnwc_: