Lineage for d1lnwb_ (1lnw B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277839Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 278193Family a.4.5.28: MarR-like transcriptional regulators [63379] (6 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 278194Protein MexR repressor [81686] (1 species)
  7. 278195Species Pseudomonas aeruginosa [TaxId:287] [81687] (1 PDB entry)
  8. 278197Domain d1lnwb_: 1lnw B: [78105]

Details for d1lnwb_

PDB Entry: 1lnw (more details), 2.1 Å

PDB Description: crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa

SCOP Domain Sequences for d1lnwb_:

Sequence, based on SEQRES records: (download)

>d1lnwb_ a.4.5.28 (B:) MexR repressor {Pseudomonas aeruginosa}
ypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqmc
rdkalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelfap
ltpveqatlvhlldqclaaqpledi

Sequence, based on observed residues (ATOM records): (download)

>d1lnwb_ a.4.5.28 (B:) MexR repressor {Pseudomonas aeruginosa}
ypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqmc
rdkalitrkirelegrnlvrrersfqlfltdeglaihqhaeaimsrvhdelfapltpveq
atlvhlldqclaaqpledi

SCOP Domain Coordinates for d1lnwb_:

Click to download the PDB-style file with coordinates for d1lnwb_.
(The format of our PDB-style files is described here.)

Timeline for d1lnwb_: