SCOP 1.69: Domain d1lnwa_: 1lnw A:

Lineage for d1lnwa_ (1lnw A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (8 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein MexR repressor [81686] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [81687] (1 PDB entry)

8. Domain d1lnwa_: 1lnw A: [78104]

Details for d1lnwa_

PDB Entry: 1lnw, 2.1 Å

PDB Description: crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa

SCOP Domain Sequences for d1lnwa_:

Sequence; same for both SEQRES and ATOM records:

>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa}
nypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqm
crdkalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelfa
pltpveqatlvhlldqclaaq

Timeline for d1lnwa_:

• d1lnwa_ first appeared in SCOP 1.63
  
• d1lnwa_ appears in SCOP 1.67
  
• d1lnwa_ appears in SCOP 1.71
  
• d1lnwa_ appears in the current release, SCOPe 2.08