Lineage for d1lnsa3 (1lns A:146-550)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135462Family c.69.1.21: PepX catalytic domain-like [69581] (4 protein domains)
  6. 2135508Protein X-Prolyl dipeptidyl aminopeptidase PepX, middle domain [82495] (1 species)
  7. 2135509Species Lactococcus lactis [TaxId:1358] [82496] (1 PDB entry)
  8. 2135510Domain d1lnsa3: 1lns A:146-550 [78103]
    Other proteins in same PDB: d1lnsa1, d1lnsa2

Details for d1lnsa3

PDB Entry: 1lns (more details), 2.2 Å

PDB Description: crystal structure analysis of the x-prolyl dipeptidyl aminopeptidase from lactococcus lactis
PDB Compounds: (A:) x-prolyl dipeptidyl aminopetidase

SCOPe Domain Sequences for d1lnsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]}
ldnhyhffndkslatfdssllerevlwvespvdseqrgendlikiqiirpksteklpvvm
taspyhlgindkandlalhdmnveleektsheihveqklpqklsakakelpivdkapyrf
thgwtyslndyfltrgfasiyvagvgtrssdgfqtsgdyqqiysmtavidwlngrarayt
srkktheikaswangkvamtgksylgtmaygaattgveglelilaeagisswynyyreng
lvrspggfpgedldvlaaltysrnldgadflkgnaeyekrlaemtaaldrksgdynqfwh
drnylintdkvkadvlivhglqdwnvtpeqaynfwkalpeghakhaflhrgahiymnswq
sidfsetinayfvaklldrdlnlnlppvilqenskdqvwtmmndf

SCOPe Domain Coordinates for d1lnsa3:

Click to download the PDB-style file with coordinates for d1lnsa3.
(The format of our PDB-style files is described here.)

Timeline for d1lnsa3: