Class a: All alpha proteins [46456] (290 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.2: X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain [81761] (1 family) automatically mapped to Pfam PF09168 |
Family a.40.2.1: X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain [81762] (1 protein) |
Protein X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain [81763] (1 species) |
Species Lactococcus lactis [TaxId:1358] [81764] (1 PDB entry) |
Domain d1lnsa1: 1lns A:1-145 [78101] Other proteins in same PDB: d1lnsa2, d1lnsa3 |
PDB Entry: 1lns (more details), 2.2 Å
SCOPe Domain Sequences for d1lnsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnsa1 a.40.2.1 (A:1-145) X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain {Lactococcus lactis [TaxId: 1358]} mrfnhfsivdknfdeqlaeldqlgfrwsvfwdekkilkdfliqspsdmtalqataeldvi eflkssieldweifwnialqlldfvpnfdfeigkafeyaknsnlpqieaemtteniisaf yyllctrrktgmilvehwvsegllp
Timeline for d1lnsa1: