Lineage for d1lnsa1 (1lns A:1-145)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712194Superfamily a.40.2: X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain [81761] (1 family) (S)
    automatically mapped to Pfam PF09168
  5. 2712195Family a.40.2.1: X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain [81762] (1 protein)
  6. 2712196Protein X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain [81763] (1 species)
  7. 2712197Species Lactococcus lactis [TaxId:1358] [81764] (1 PDB entry)
  8. 2712198Domain d1lnsa1: 1lns A:1-145 [78101]
    Other proteins in same PDB: d1lnsa2, d1lnsa3

Details for d1lnsa1

PDB Entry: 1lns (more details), 2.2 Å

PDB Description: crystal structure analysis of the x-prolyl dipeptidyl aminopeptidase from lactococcus lactis
PDB Compounds: (A:) x-prolyl dipeptidyl aminopeptidase

SCOPe Domain Sequences for d1lnsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnsa1 a.40.2.1 (A:1-145) X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain {Lactococcus lactis [TaxId: 1358]}
mrfnhfsivdknfdeqlaeldqlgfrwsvfwdekkilkdfliqspsdmtalqataeldvi
eflkssieldweifwnialqlldfvpnfdfeigkafeyaknsnlpqieaemtteniisaf
yyllctrrktgmilvehwvsegllp

SCOPe Domain Coordinates for d1lnsa1:

Click to download the PDB-style file with coordinates for d1lnsa1.
(The format of our PDB-style files is described here.)

Timeline for d1lnsa1: