Lineage for d1llfa_ (1llf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135098Family c.69.1.17: Fungal lipases [53558] (5 protein domains)
  6. 2135196Protein Type-B carboxylesterase/lipase [53566] (4 species)
  7. 2135197Species Candida cylindracea, cholesterol esterase [TaxId:44322] [53569] (2 PDB entries)
  8. 2135198Domain d1llfa_: 1llf A: [78094]
    complexed with f23

Details for d1llfa_

PDB Entry: 1llf (more details), 1.4 Å

PDB Description: Cholesterol Esterase (Candida Cylindracea) Crystal Structure at 1.4A resolution
PDB Compounds: (A:) Lipase 3

SCOPe Domain Sequences for d1llfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]}
aptaklangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgslngqkftsygpsc
mqqnpegtfeenlgktaldlvmqskvfqavlpqsedcltinvvrppgtkaganlpvmlwi
fgggfeigsptifppaqmvtksvlmgkpiihvavnyrvaswgflagddikaegsgnaglk
dqrlgmqwvadniagfggdpskvtifgesagsmsvlchliwndgdntykgkplfragimq
sgamvpsdpvdgtygneiydlfvssagcgsasdklaclrsassdtlldatnntpgflays
slrlsylprpdgknitddmyklvrdgkyasvpviigdqndegtifglsslnvttnaqara
yfkqsfihasdaeidtlmaaypqditqgspfdtgifnaitpqfkrisavlgdlafiharr
yflnhfqggtkysflskqlsglpimgtfhandivwqdyllgsgsviynnafiafatdldp
ntagllvnwpkytsssqsgnnlmminalglytgkdnfrtagydalmtnpssffv

SCOPe Domain Coordinates for d1llfa_:

Click to download the PDB-style file with coordinates for d1llfa_.
(The format of our PDB-style files is described here.)

Timeline for d1llfa_: