Lineage for d1ll9b_ (1ll9 B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3012734Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 3012776Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (115 PDB entries)
  8. 3012884Domain d1ll9b_: 1ll9 B: [78091]
    complexed with axl

Details for d1ll9b_

PDB Entry: 1ll9 (more details), 1.87 Å

PDB Description: Crystal Structure Of AmpC beta-Lactamase From E. Coli In Complex With Amoxicillin
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1ll9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll9b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d1ll9b_:

Click to download the PDB-style file with coordinates for d1ll9b_.
(The format of our PDB-style files is described here.)

Timeline for d1ll9b_: