Lineage for d1ll9a_ (1ll9 A:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517216Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 517217Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 517218Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)
  6. 517219Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 517237Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (32 PDB entries)
  8. 517270Domain d1ll9a_: 1ll9 A: [78090]

Details for d1ll9a_

PDB Entry: 1ll9 (more details), 1.87 Å

PDB Description: Crystal Structure Of AmpC beta-Lactamase From E. Coli In Complex With Amoxicillin

SCOP Domain Sequences for d1ll9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll9a_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOP Domain Coordinates for d1ll9a_:

Click to download the PDB-style file with coordinates for d1ll9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ll9a_: