Lineage for d1ll7b2 (1ll7 B:293-354)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941865Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2941866Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2941867Protein Chitinase 1 [54562] (2 species)
  7. 2941897Species Fungus (Coccidioides immitis) [TaxId:5501] [54563] (4 PDB entries)
  8. 2941899Domain d1ll7b2: 1ll7 B:293-354 [78088]
    Other proteins in same PDB: d1ll7a1, d1ll7b1
    mutant

Details for d1ll7b2

PDB Entry: 1ll7 (more details), 2 Å

PDB Description: structure of the e171q mutant of c. immitis chitinase 1
PDB Compounds: (B:) chitinase 1

SCOPe Domain Sequences for d1ll7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll7b2 d.26.3.1 (B:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]}
ygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtelediaasysydknkryli
sy

SCOPe Domain Coordinates for d1ll7b2:

Click to download the PDB-style file with coordinates for d1ll7b2.
(The format of our PDB-style files is described here.)

Timeline for d1ll7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ll7b1