Lineage for d1ll7a1 (1ll7 A:36-292,A:355-427)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083165Family c.1.8.5: Type II chitinase [51534] (15 protein domains)
    glycosylase family 18
  6. 2083166Protein Chitinase 1 [51548] (2 species)
  7. 2083196Species Fungus (Coccidioides immitis) [TaxId:5501] [51549] (4 PDB entries)
  8. 2083197Domain d1ll7a1: 1ll7 A:36-292,A:355-427 [78085]
    Other proteins in same PDB: d1ll7a2, d1ll7b2
    mutant

Details for d1ll7a1

PDB Entry: 1ll7 (more details), 2 Å

PDB Description: structure of the e171q mutant of c. immitis chitinase 1
PDB Compounds: (A:) chitinase 1

SCOPe Domain Sequences for d1ll7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]}
ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
klmkdlgfdgididwqypedekqandfvlllkacrealdaysakhpngkkflltiaspag
pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
yikagvpankivlgmplXdtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvvn
glggtgkleqrenelsypesvydnlkngmps

SCOPe Domain Coordinates for d1ll7a1:

Click to download the PDB-style file with coordinates for d1ll7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ll7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ll7a2