Lineage for d1ll6b1 (1ll6 B:36-292,B:355-427)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816441Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 816442Protein Chitinase 1 [51548] (2 species)
  7. 816472Species Fungus (Coccidioides immitis) [TaxId:5501] [51549] (4 PDB entries)
  8. 816477Domain d1ll6b1: 1ll6 B:36-292,B:355-427 [78079]
    Other proteins in same PDB: d1ll6a2, d1ll6b2, d1ll6c2, d1ll6d2

Details for d1ll6b1

PDB Entry: 1ll6 (more details), 2.8 Å

PDB Description: structure of the d169n mutant of c. immitis chitinase 1
PDB Compounds: (B:) chitinase 1

SCOP Domain Sequences for d1ll6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll6b1 c.1.8.5 (B:36-292,B:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]}
ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
klmkdlgfdgidinweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
yikagvpankivlgmplXdtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvvn
glggtgkleqrenelsypesvydnlkngmps

SCOP Domain Coordinates for d1ll6b1:

Click to download the PDB-style file with coordinates for d1ll6b1.
(The format of our PDB-style files is described here.)

Timeline for d1ll6b1: