SCOP 1.65: Domain d1ll6b1: 1ll6 B:36-292,B:355-427

Lineage for d1ll6b1 (1ll6 B:36-292,B:355-427)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.5: Type II chitinase [51534] (14 proteins)
   glycosylase family 18

6. Protein Chitinase 1 [51548] (1 species)

7. Species Fungus (Coccidioides immitis) [TaxId:5501] [51549] (4 PDB entries)

8. Domain d1ll6b1: 1ll6 B:36-292,B:355-427 [78079]
   Other proteins in same PDB: d1ll6a2, d1ll6b2, d1ll6c2, d1ll6d2

Details for d1ll6b1

PDB Entry: 1ll6, 2.8 Å

PDB Description: structure of the d169n mutant of c. immitis chitinase 1

SCOP Domain Sequences for d1ll6b1:

Sequence; same for both SEQRES and ATOM records:

>d1ll6b1 c.1.8.5 (B:36-292,B:355-427) Chitinase 1 {Fungus (Coccidioides immitis)}
ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
klmkdlgfdgidinweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
yikagvpankivlgmplXdtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvvn
glggtgkleqrenelsypesvydnlkngmps

Timeline for d1ll6b1:

• d1ll6b1 first appeared in SCOP 1.63
  
• d1ll6b1 appears in SCOP 1.67
  
• d1ll6b1 appears in the current release, SCOPe 2.08