Lineage for d1ll4a2 (1ll4 A:293-354)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408694Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1408695Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1408696Protein Chitinase 1 [54562] (2 species)
  7. 1408726Species Fungus (Coccidioides immitis) [TaxId:5501] [54563] (4 PDB entries)
  8. 1408734Domain d1ll4a2: 1ll4 A:293-354 [78068]
    Other proteins in same PDB: d1ll4a1, d1ll4b1, d1ll4c1, d1ll4d1
    complexed with ami

Details for d1ll4a2

PDB Entry: 1ll4 (more details), 2.8 Å

PDB Description: structure of c. immitis chitinase 1 complexed with allosamidin
PDB Compounds: (A:) chitinase 1

SCOPe Domain Sequences for d1ll4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll4a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]}
ygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtelediaasysydknkryli
sy

SCOPe Domain Coordinates for d1ll4a2:

Click to download the PDB-style file with coordinates for d1ll4a2.
(The format of our PDB-style files is described here.)

Timeline for d1ll4a2: