Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1lkpa1 (1lkp A:2-147)

  1. Root: SCOP 1.75
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (9 protein domains)
  6. Protein Rubrerythrin, N-terminal domain [47242] (2 species)
  7. Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries)
    Uniprot P24931
  8. Domain d1lkpa1: 1lkp A:2-147 [78065]
    Other proteins in same PDB: d1lkpa2
    complexed with azi, fe2

Details for d1lkpa1

PDB Entry: 1lkp (more details)
PDB Description: crystal structure of desulfovibrio vulgaris rubrerythrin all form, azide adduct
PDB Compounds: (A:) rubrerythrin

SCOP Domain Sequences for d1lkpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkpa1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv

SCOP Domain Coordinates for d1lkpa1:

Click to download the PDB-style file with coordinates for d1lkpa1.
(The format of our PDB-style files is described here.)

Timeline for d1lkpa1:

d1lkpa1 appears in SCOP 1.73
d1lkpa1 appears in SCOP 1.75A


d1lkpa1
(click for larger image)


d1lkpa1 in context of chain
Domains from same chain:
d1lkpa2

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu