Lineage for d1lk9b_ (1lk9 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131001Protein Alliinase [82482] (1 species)
    cysteine sulphoxide lyase
  7. 2131002Species Garlic (Allium sativum) [TaxId:4682] [82483] (1 PDB entry)
  8. 2131004Domain d1lk9b_: 1lk9 B: [78058]
    complexed with cl, dha, epe, plp, so4

Details for d1lk9b_

PDB Entry: 1lk9 (more details), 1.53 Å

PDB Description: The Three-dimensional Structure of Alliinase from Garlic
PDB Compounds: (B:) alliin lyase

SCOPe Domain Sequences for d1lk9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk9b_ c.67.1.1 (B:) Alliinase {Garlic (Allium sativum) [TaxId: 4682]}
kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad
vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa
akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy
vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka
dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev
vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps
psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd
mvkakrk

SCOPe Domain Coordinates for d1lk9b_:

Click to download the PDB-style file with coordinates for d1lk9b_.
(The format of our PDB-style files is described here.)

Timeline for d1lk9b_: