SCOP 1.69: Domain d1ljta_: 1ljt A:

Lineage for d1ljta_ (1ljt A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (5 families)

5. Family d.80.1.3: MIF-related [55339] (2 proteins)

6. Protein Microphage migration inhibition factor (MIF) [55340] (5 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Human (Homo sapiens) [TaxId:9606] [55341] (8 PDB entries)

8. Domain d1ljta_: 1ljt A: [78053]

Details for d1ljta_

PDB Entry: 1ljt, 2 Å

PDB Description: Crystal Structure of Macrophage Migration Inhibitory Factor complexed with (S,R)-3-(4-hydroxyphenyl)-4,5-dihydro-5-isoxazole-acetic acid methyl ester (ISO-1)

SCOP Domain Sequences for d1ljta_:

Sequence; same for both SEQRES and ATOM records:

>d1ljta_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens)}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

Timeline for d1ljta_:

• d1ljta_ first appeared in SCOP 1.63
  
• d1ljta_ appears in SCOP 1.67
  
• d1ljta_ appears in SCOP 1.71
  
• d1ljta_ appears in the current release, SCOPe 2.08