Lineage for d1ljta_ (1ljt A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259074Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 259075Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) (S)
  5. 259144Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 259150Protein Microphage migration inhibition factor (MIF) [55340] (4 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 259151Species Human (Homo sapiens) [TaxId:9606] [55341] (8 PDB entries)
  8. 259164Domain d1ljta_: 1ljt A: [78053]

Details for d1ljta_

PDB Entry: 1ljt (more details), 2 Å

PDB Description: Crystal Structure of Macrophage Migration Inhibitory Factor complexed with (S,R)-3-(4-hydroxyphenyl)-4,5-dihydro-5-isoxazole-acetic acid methyl ester (ISO-1)

SCOP Domain Sequences for d1ljta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ljta_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens)}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOP Domain Coordinates for d1ljta_:

Click to download the PDB-style file with coordinates for d1ljta_.
(The format of our PDB-style files is described here.)

Timeline for d1ljta_: