![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (7 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
![]() | Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tussues ans secretions |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53969] (202 PDB entries) |
![]() | Domain d1ljhb_: 1ljh B: [78044] complexed with no3 |
PDB Entry: 1ljh (more details), 1.8 Å
SCOP Domain Sequences for d1ljhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ljhb_ d.2.1.2 (B:) Lysozyme {Human (Homo sapiens)} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d1ljhb_: