Lineage for d1lj9b_ (1lj9 B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210555Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 210893Family a.4.5.28: MarR-like transcriptional regulators [63379] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 210915Protein Transcriptional regulator SlyA [81688] (1 species)
  7. 210916Species Enterococcus faecalis [TaxId:1351] [81689] (1 PDB entry)
  8. 210918Domain d1lj9b_: 1lj9 B: [78036]
    structural genomics protein

Details for d1lj9b_

PDB Entry: 1lj9 (more details), 1.6 Å

PDB Description: the crystal structure of the transcriptional regulator slya

SCOP Domain Sequences for d1lj9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lj9b_ a.4.5.28 (B:) Transcriptional regulator SlyA {Enterococcus faecalis}
tdilreigmiaraldsisniefkelsltrgqylylvrvcenpgiiqekiaelikvdrtta
araikrleeqgfiyrqedasnkkikriyatekgknvypiivrenqhsnqvalqglsevei
sqladylvrmrknvsedwefvk

SCOP Domain Coordinates for d1lj9b_:

Click to download the PDB-style file with coordinates for d1lj9b_.
(The format of our PDB-style files is described here.)

Timeline for d1lj9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lj9a_