![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.28: MarR-like transcriptional regulators [63379] (5 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein Transcriptional regulator SlyA [81688] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [81689] (1 PDB entry) |
![]() | Domain d1lj9b_: 1lj9 B: [78036] structural genomics protein |
PDB Entry: 1lj9 (more details), 1.6 Å
SCOP Domain Sequences for d1lj9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lj9b_ a.4.5.28 (B:) Transcriptional regulator SlyA {Enterococcus faecalis} tdilreigmiaraldsisniefkelsltrgqylylvrvcenpgiiqekiaelikvdrtta araikrleeqgfiyrqedasnkkikriyatekgknvypiivrenqhsnqvalqglsevei sqladylvrmrknvsedwefvk
Timeline for d1lj9b_: