Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Transcriptional regulator SlyA [81688] (2 species) |
Species Enterococcus faecalis [TaxId:1351] [81689] (1 PDB entry) |
Domain d1lj9a_: 1lj9 A: [78035] |
PDB Entry: 1lj9 (more details), 1.6 Å
SCOPe Domain Sequences for d1lj9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} tdilreigmiaraldsisniefkelsltrgqylylvrvcenpgiiqekiaelikvdrtta araikrleeqgfiyrqedasnkkikriyatekgknvypiivrenqhsnqvalqglsevei sqladylvrmrknvsedwefvkkg
Timeline for d1lj9a_: