SCOP 1.67: Domain d1lj9a_: 1lj9 A:

Lineage for d1lj9a_ (1lj9 A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (8 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Transcriptional regulator SlyA [81688] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [81689] (1 PDB entry)

8. Domain d1lj9a_: 1lj9 A: [78035]

Details for d1lj9a_

PDB Entry: 1lj9, 1.6 Å

PDB Description: the crystal structure of the transcriptional regulator slya

SCOP Domain Sequences for d1lj9a_:

Sequence; same for both SEQRES and ATOM records:

>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis}
tdilreigmiaraldsisniefkelsltrgqylylvrvcenpgiiqekiaelikvdrtta
araikrleeqgfiyrqedasnkkikriyatekgknvypiivrenqhsnqvalqglsevei
sqladylvrmrknvsedwefvkkg

Timeline for d1lj9a_:

• d1lj9a_ first appeared in SCOP 1.63
  
• d1lj9a_ appears in SCOP 1.65
  
• d1lj9a_ appears in SCOP 1.69
  
• d1lj9a_ appears in the current release, SCOPe 2.08