Lineage for d1lj1b1 (1lj1 B:1-102)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649671Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 649672Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 649759Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 649790Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)
  7. 649791Species Shewanella frigidimarina [TaxId:56812] [48722] (16 PDB entries)
  8. 649805Domain d1lj1b1: 1lj1 B:1-102 [78026]
    Other proteins in same PDB: d1lj1a2, d1lj1a3, d1lj1b2, d1lj1b3
    complexed with fad, fum, hem, na; mutant

Details for d1lj1b1

PDB Entry: 1lj1 (more details), 2 Å

PDB Description: crystal structure of q363f/r402a mutant flavocytochrome c3
PDB Compounds: (B:) flavocytochrome c3

SCOP Domain Sequences for d1lj1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lj1b1 a.138.1.3 (B:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

SCOP Domain Coordinates for d1lj1b1:

Click to download the PDB-style file with coordinates for d1lj1b1.
(The format of our PDB-style files is described here.)

Timeline for d1lj1b1: