Lineage for d1lj0d_ (1lj0 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579636Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2579637Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2579638Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2579639Protein Cytochrome b5 [55858] (4 species)
  7. 2579661Species Norway rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries)
  8. 2579665Domain d1lj0d_: 1lj0 D: [78022]
    complexed with hem, mg; mutant

Details for d1lj0d_

PDB Entry: 1lj0 (more details), 2 Å

PDB Description: structure of quintuple mutant of the rat outer mitocondrial cytochrome b5.
PDB Compounds: (D:) cytochrome b5 outer mitochondrial membrane isoform

SCOPe Domain Sequences for d1lj0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lj0d_ d.120.1.1 (D:) Cytochrome b5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pavtyyrleevakrntseetwmvlhgrvydltrflsehpggeevlreqagadatesfedv
ghspdaremskqyyigdvhpndlkpk

SCOPe Domain Coordinates for d1lj0d_:

Click to download the PDB-style file with coordinates for d1lj0d_.
(The format of our PDB-style files is described here.)

Timeline for d1lj0d_: