Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) |
Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) |
Protein Cytochrome b5 [55858] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries) |
Domain d1lj0b_: 1lj0 B: [78020] complexed with hem, mg; mutant |
PDB Entry: 1lj0 (more details), 2 Å
SCOPe Domain Sequences for d1lj0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lj0b_ d.120.1.1 (B:) Cytochrome b5 {Norway rat (Rattus norvegicus) [TaxId: 10116]} gsdpavtyyrleevakrntseetwmvlhgrvydltrflsehpggeevlreqagadatesf edvghspdaremskqyyigdvhpndlkpk
Timeline for d1lj0b_: