Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) |
Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) |
Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries) |
Domain d1liyb3: 1liy B:440-573 [78011] Other proteins in same PDB: d1liya1, d1liya2, d1liyb1, d1liyb2, d1liyc1, d1liyc2, d1liyd1, d1liyd2 |
PDB Entry: 1liy (more details), 2.74 Å
SCOP Domain Sequences for d1liyb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1liyb3 c.49.1.1 (B:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} elrraaplsrdptevtaigaveaafkccaaaiivltttghsaqllsryrpraaviavtrs aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr pgsgytnimrvlsi
Timeline for d1liyb3: