Lineage for d1lixd3 (1lix D:440-573)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 834980Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 834981Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 834982Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 834983Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 835004Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries)
  8. 835020Domain d1lixd3: 1lix D:440-573 [78005]
    Other proteins in same PDB: d1lixa1, d1lixa2, d1lixb1, d1lixb2, d1lixc1, d1lixc2, d1lixd1, d1lixd2
    complexed with fbp, k, mn, pga; mutant

Details for d1lixd3

PDB Entry: 1lix (more details), 2.87 Å

PDB Description: Human erythrocyte pyruvate kinase: Arg486Trp mutant
PDB Compounds: (D:) Pyruvate kinase, isozymes R/L

SCOP Domain Sequences for d1lixd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lixd3 c.49.1.1 (D:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllswyrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

SCOP Domain Coordinates for d1lixd3:

Click to download the PDB-style file with coordinates for d1lixd3.
(The format of our PDB-style files is described here.)

Timeline for d1lixd3: