Lineage for d1lixc3 (1lix C:440-573)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585557Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 585558Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 585559Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 585560Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 585581Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries)
  8. 585596Domain d1lixc3: 1lix C:440-573 [78002]
    Other proteins in same PDB: d1lixa1, d1lixa2, d1lixb1, d1lixb2, d1lixc1, d1lixc2, d1lixd1, d1lixd2

Details for d1lixc3

PDB Entry: 1lix (more details), 2.87 Å

PDB Description: Human erythrocyte pyruvate kinase: Arg486Trp mutant

SCOP Domain Sequences for d1lixc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lixc3 c.49.1.1 (C:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens)}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllswyrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

SCOP Domain Coordinates for d1lixc3:

Click to download the PDB-style file with coordinates for d1lixc3.
(The format of our PDB-style files is described here.)

Timeline for d1lixc3: