Lineage for d1lixc1 (1lix C:160-261)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805738Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 805739Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 805740Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 805741Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 805762Species Human (Homo sapiens) [TaxId:9606] [82151] (4 PDB entries)
  8. 805777Domain d1lixc1: 1lix C:160-261 [78000]
    Other proteins in same PDB: d1lixa2, d1lixa3, d1lixb2, d1lixb3, d1lixc2, d1lixc3, d1lixd2, d1lixd3

Details for d1lixc1

PDB Entry: 1lix (more details), 2.87 Å

PDB Description: Human erythrocyte pyruvate kinase: Arg486Trp mutant
PDB Compounds: (C:) Pyruvate kinase, isozymes R/L

SCOP Domain Sequences for d1lixc1:

Sequence, based on SEQRES records: (download)

>d1lixc1 b.58.1.1 (C:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]}
peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi
ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgaqvdl

Sequence, based on observed residues (ATOM records): (download)

>d1lixc1 b.58.1.1 (C:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]}
peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi
ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgadl

SCOP Domain Coordinates for d1lixc1:

Click to download the PDB-style file with coordinates for d1lixc1.
(The format of our PDB-style files is described here.)

Timeline for d1lixc1: