Lineage for d1lixa3 (1lix A:440-573)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245438Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 245439Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 245440Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 245441Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 245462Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries)
  8. 245475Domain d1lixa3: 1lix A:440-573 [77996]
    Other proteins in same PDB: d1lixa1, d1lixa2, d1lixb1, d1lixb2, d1lixc1, d1lixc2, d1lixd1, d1lixd2

Details for d1lixa3

PDB Entry: 1lix (more details), 2.87 Å

PDB Description: Human erythrocyte pyruvate kinase: Arg486Trp mutant

SCOP Domain Sequences for d1lixa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lixa3 c.49.1.1 (A:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens)}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllswyrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

SCOP Domain Coordinates for d1lixa3:

Click to download the PDB-style file with coordinates for d1lixa3.
(The format of our PDB-style files is described here.)

Timeline for d1lixa3: