Lineage for d1liwd3 (1liw D:440-573)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316067Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 316068Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 316069Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 316070Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 316091Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries)
  8. 316099Domain d1liwd3: 1liw D:440-573 [77993]
    Other proteins in same PDB: d1liwa1, d1liwa2, d1liwb1, d1liwb2, d1liwc1, d1liwc2, d1liwd1, d1liwd2
    complexed with fbp, k, mn, pga; mutant

Details for d1liwd3

PDB Entry: 1liw (more details), 2.75 Å

PDB Description: Human erythrocyte pyruvate kinase: Thr384Met mutant

SCOP Domain Sequences for d1liwd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liwd3 c.49.1.1 (D:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens)}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

SCOP Domain Coordinates for d1liwd3:

Click to download the PDB-style file with coordinates for d1liwd3.
(The format of our PDB-style files is described here.)

Timeline for d1liwd3: