Lineage for d1liwc2 (1liw C:57-159,C:262-439)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 237513Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 237514Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 237515Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 237536Species Human (Homo sapiens) [TaxId:9606] [82273] (4 PDB entries)
  8. 237543Domain d1liwc2: 1liw C:57-159,C:262-439 [77989]
    Other proteins in same PDB: d1liwa1, d1liwa3, d1liwb1, d1liwb3, d1liwc1, d1liwc3, d1liwd1, d1liwd3

Details for d1liwc2

PDB Entry: 1liw (more details), 2.75 Å

PDB Description: Human erythrocyte pyruvate kinase: Thr384Met mutant

SCOP Domain Sequences for d1liwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liwc2 c.1.12.1 (C:57-159,C:262-439) Pyruvate kinase, N-terminal domain {Human (Homo sapiens)}
qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgXpglseqdvrdlrfgve
hgvdivfasfvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvar
gdlgieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkprpmraetsdvanavld
gadcimlsgetakgnfpveavkmqhaiareaeaavyhrqlfe

SCOP Domain Coordinates for d1liwc2:

Click to download the PDB-style file with coordinates for d1liwc2.
(The format of our PDB-style files is described here.)

Timeline for d1liwc2: