Lineage for d1liwc1 (1liw C:160-261)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300825Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 300826Superfamily b.58.1: PK beta-barrel domain-like [50800] (1 family) (S)
  5. 300827Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 300828Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 300849Species Human (Homo sapiens) [TaxId:9606] [82151] (4 PDB entries)
  8. 300856Domain d1liwc1: 1liw C:160-261 [77988]
    Other proteins in same PDB: d1liwa2, d1liwa3, d1liwb2, d1liwb3, d1liwc2, d1liwc3, d1liwd2, d1liwd3

Details for d1liwc1

PDB Entry: 1liw (more details), 2.75 Å

PDB Description: Human erythrocyte pyruvate kinase: Thr384Met mutant

SCOP Domain Sequences for d1liwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liwc1 b.58.1.1 (C:160-261) Pyruvate kinase (PK) {Human (Homo sapiens)}
peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi
ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgaqvdl

SCOP Domain Coordinates for d1liwc1:

Click to download the PDB-style file with coordinates for d1liwc1.
(The format of our PDB-style files is described here.)

Timeline for d1liwc1: