Lineage for d1liwb3 (1liw B:440-573)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245438Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 245439Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 245440Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 245441Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 245462Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries)
  8. 245468Domain d1liwb3: 1liw B:440-573 [77987]
    Other proteins in same PDB: d1liwa1, d1liwa2, d1liwb1, d1liwb2, d1liwc1, d1liwc2, d1liwd1, d1liwd2

Details for d1liwb3

PDB Entry: 1liw (more details), 2.75 Å

PDB Description: Human erythrocyte pyruvate kinase: Thr384Met mutant

SCOP Domain Sequences for d1liwb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liwb3 c.49.1.1 (B:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens)}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

SCOP Domain Coordinates for d1liwb3:

Click to download the PDB-style file with coordinates for d1liwb3.
(The format of our PDB-style files is described here.)

Timeline for d1liwb3: