Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) |
Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) |
Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries) |
Domain d1liub3: 1liu B:440-573 [77975] Other proteins in same PDB: d1liua1, d1liua2, d1liub1, d1liub2, d1liuc1, d1liuc2, d1liud1, d1liud2 |
PDB Entry: 1liu (more details), 2.72 Å
SCOP Domain Sequences for d1liub3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1liub3 c.49.1.1 (B:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens)} elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrs aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr pgsgytnimrvlsi
Timeline for d1liub3: