Lineage for d1lhva_ (1lhv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779593Protein Sex hormone-binding globulin [49945] (1 species)
  7. 2779594Species Human (Homo sapiens) [TaxId:9606] [49946] (9 PDB entries)
  8. 2779603Domain d1lhva_: 1lhv A: [77965]
    complexed with ca, ipa, nog, zn

Details for d1lhva_

PDB Entry: 1lhv (more details), 2 Å

PDB Description: crystal structure of the n-terminal lg-domain of shbg in complex with norgestrel
PDB Compounds: (A:) sex hormone-binding globulin

SCOPe Domain Sequences for d1lhva_:

Sequence, based on SEQRES records: (download)

>d1lhva_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]}
ppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlglr
dgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsgplt
skrhpimrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrscd

Sequence, based on observed residues (ATOM records): (download)

>d1lhva_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]}
ppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlglr
dgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsgplh
pimrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrscd

SCOPe Domain Coordinates for d1lhva_:

Click to download the PDB-style file with coordinates for d1lhva_.
(The format of our PDB-style files is described here.)

Timeline for d1lhva_: