Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
Protein Sex hormone-binding globulin [49945] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49946] (9 PDB entries) |
Domain d1lhoa_: 1lho A: [77959] complexed with aom, ca |
PDB Entry: 1lho (more details), 2 Å
SCOPe Domain Sequences for d1lhoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lhoa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} ppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlglr dgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsgplt skrhpimrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrsc
Timeline for d1lhoa_: