Lineage for d1lhna_ (1lhn A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050810Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2050871Protein Sex hormone-binding globulin [49945] (1 species)
  7. 2050872Species Human (Homo sapiens) [TaxId:9606] [49946] (9 PDB entries)
  8. 2050879Domain d1lhna_: 1lhn A: [77958]
    complexed with aon, ca, zn

Details for d1lhna_

PDB Entry: 1lhn (more details), 2 Å

PDB Description: crystal structure of the n-terminal lg-domain of shbg in complex with 5alpha-androstane-3beta,17alpha-diol
PDB Compounds: (A:) sex hormone-binding globulin

SCOPe Domain Sequences for d1lhna_:

Sequence, based on SEQRES records: (download)

>d1lhna_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]}
ppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlglr
dgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsgplt
skrhpimrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrscd

Sequence, based on observed residues (ATOM records): (download)

>d1lhna_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]}
ppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlglr
dgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsgplt
skhpimrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrscd

SCOPe Domain Coordinates for d1lhna_:

Click to download the PDB-style file with coordinates for d1lhna_.
(The format of our PDB-style files is described here.)

Timeline for d1lhna_: