SCOP 1.63: Domain d1lgta2: 1lgt A:133-288

Lineage for d1lgta2 (1lgt A:133-288)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species)

7. Species Burkholderia cepacia (formerly Pseudomonas cepacia) [54605] (6 PDB entries)

8. Domain d1lgta2: 1lgt A:133-288 [77957]
   complexed with bp3, fe2

Details for d1lgta2

PDB Entry: 1lgt, 1.7 Å

PDB Description: crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase (dhbd) complexed with 2'-cl dihydroxybiphenyl (dhb)

SCOP Domain Sequences for d1lgta2:

Sequence; same for both SEQRES and ATOM records:

>d1lgta2 d.32.1.3 (A:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia (formerly Pseudomonas cepacia)}
avsgfltgeqglghfvrcvpdsdkalafytdvlgfqlsdvidmkmgpdvtvpayflhcne
rhhtlaiaafplpkrihhfmlevaslddvgfafdrvdadglitstlgrhtndhmvsfyas
tpsgveveygwsartvdrswvvvrhdspsmwghksv

Timeline for d1lgta2:

• d1lgta2 is new in SCOP 1.63
  
• d1lgta2 appears in SCOP 1.65
  
• d1lgta2 appears in the current release, SCOPe 2.08