Lineage for d1lgta2 (1lgt A:133-288)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
duplication: consists of 2 similar domains with 2 repeats in each
Similar to the Methylmalonyl-CoA epimerase dimer
Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species) 
Species Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId:292] [54605] (6 PDB entries) 
Domain d1lgta2: 1lgt A:133-288 [77957]
complexed with bp3, fe2
Details for d1lgta2
PDB Entry: 1lgt (more details), 1.7 Å
PDB Description: crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase (dhbd) complexed with 2'-cl dihydroxybiphenyl (dhb)
PDB Compounds: (A:) biphenyl-2,3-diol 1,2-dioxygenaseSCOPe Domain Sequences for d1lgta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lgta2 d.32.1.3 (A:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]}
avsgfltgeqglghfvrcvpdsdkalafytdvlgfqlsdvidmkmgpdvtvpayflhcne
rhhtlaiaafplpkrihhfmlevaslddvgfafdrvdadglitstlgrhtndhmvsfyas
tpsgveveygwsartvdrswvvvrhdspsmwghksv
SCOPe Domain Coordinates for d1lgta2:
Click to download the PDB-style file with coordinates for d1lgta2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lgta2:
- d1lgta2 first appeared in SCOP 1.63
- d1lgta2 appears in SCOPe 2.07
View in 3D
